PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN02506.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 291aa    MW: 33110.9 Da    PI: 5.066
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN02506.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++++ +G  +W++ ++  g+ R++k+c++rw +yl
       KHN02506.1 14 RGPWTPEEDQILINYINTYGHANWRALPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding47.63.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++ ++ ++++lG++ W++Ia+++  gRt++++k+ w+++l
       KHN02506.1  67 RGNFTREEEDTIISLHEMLGNR-WSAIAARLS-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.162961IPR017930Myb domain
SuperFamilySSF466895.99E-3010108IPR009057Homeodomain-like
SMARTSM007173.6E-141363IPR001005SANT/Myb domain
PfamPF002497.5E-161461IPR001005SANT/Myb domain
CDDcd001672.31E-111661No hitNo description
PROSITE profilePS5129424.14662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2565116IPR009057Homeodomain-like
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PfamPF002495.2E-1467112IPR001005SANT/Myb domain
CDDcd001671.69E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDQILINYIN TYGHANWRAL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEDTIIS LHEMLGNRWS AIAARLSGRT DNEIKNVWHT HLKKRLPQNY  120
QQSHHTKKRS KKQPPKLDAD ASKSNQDAKL EQQDPVNIHG SNSEDMMMPL SPPHCSSDMS  180
SSLTTSDNNS NVNIINNNHD MSLNVNDYDI DTPENNLALD EDFWSEVLSS DNSGVTSGFP  240
TLDYDQFQPM SPLVTEEGVL IDCSSSTCDD GMDFWCNVYS RAEEFTQLLE L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9791360.0KC979136.1 Glycine max cultivar Jindou 21 MYB4-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304532.10.0myb-related protein Myb4-like
TrEMBLA0A0B2NZC70.0A0A0B2NZC7_GLYSO; Myb-related protein Myb4
TrEMBLK7MYP50.0K7MYP5_SOYBN; MYB4-like protein
STRINGGLYMA19G34740.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-80myb domain protein 14
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]